DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and sv

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster


Alignment Length:323 Identity:65/323 - (20%)
Similarity:106/323 - (32%) Gaps:105/323 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DLDVSYDDSAVLGQLDS-----ALG---GGGTLLPDTP------PQSSNSLDNELKASYGTGAMS 134
            |..:.||....:.|..|     |:|   |.|:|.|..|      ..|:||:..:           
  Fly   530 DTSMLYDSITTISQTQSSIYTPAIGPSIGTGSLTPLVPISMHEMKLSANSIQEQ----------- 583

  Fly   135 PSRLSPNIFLNLNID-----HLGLERGGSGLSMEWSTYPPQTQAQT------------------- 175
               ..|..:..|..|     ...||...|.:..|....|..:.:.|                   
  Fly   584 ---TVPPFYTALAFDGNYTSMTSLENCSSLVGQEHIVMPESSDSNTLCPISTRIVPDITETNSTR 645

  Fly   176 --HPQMDSD------NQLQQHPPQQHASDPIHAGSSSHH--QQQQQQHQQEQHNPQLHPGLEFAA 230
              .|..:||      |:..:......:||.| |....||  ::|.:.:::...|...||    ::
  Fly   646 VKEPLTNSDGCSEDNNKEPEKSNSSQSSDHI-ASPHLHHIGEEQLRGNRRSNLNASTHP----SS 705

  Fly   231 SLSLDMTDGSSAYD----------EMKFLSVDVDQF-------TIDSFKADCILSMEQSQMQ--- 275
            .:.|..:.|||..:          |:. ||.:|..:       :.:.:.|.|...:..|...   
  Fly   706 LIPLQPSGGSSLLNINPSENRSDVELN-LSNNVGLYSTPTVLPSFNHYSAGCSSVVPGSDYAYNP 769

  Fly   276 -------AYGGHSQLVGSSNELCLDGIGMSSFGMEEGEPKSPPSLLVLDKSLPSLSIGVEGIA 331
                   |||.:....||       |:..||:..|.|:.:||   |..|...|.::.....:|
  Fly   770 AYTQYGGAYGSYGYGTGS-------GLINSSYYYESGQTQSP---LTHDLRSPLVATRANSLA 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475
svNP_524633.3 PAX 175..299 CDD:128645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.