DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Rhox2f

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001078825.1 Gene:Rhox2f / 434764 MGIID:3770275 Length:191 Species:Mus musculus


Alignment Length:59 Identity:26/59 - (44%)
Similarity:35/59 - (59%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            :|.:||.|||||||..||..||........||..:.::||.||.||..||.|:|..:::
Mouse   133 WRHSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQEWFLKRREKYRSYKRL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 25/53 (47%)
Rhox2fNP_001078825.1 homeodomain 134..186 CDD:238039 25/51 (49%)

Return to query results.
Submit another query.