DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ftz

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:199 Identity:54/199 - (27%)
Similarity:78/199 - (39%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            :..:|.|.|:...|..|||:.|....|.....|.::|..:.|:|.::::||||||.|.:|...:.
  Fly   252 KDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLD 316

  Fly    73 G----LGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTP-PQSSNSLDNELKASYGTGA 132
            .    .|..|             :|:|..|: |.....|..|..| |...:   ::..|:|...:
  Fly   317 SSPEHCGAGY-------------TAMLPPLE-ATSTATTGAPSVPVPMYHH---HQTTAAYPAYS 364

  Fly   133 MSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQH--PPQQHAS 195
            .|.|.                   |.||   .:.||   |.|||.|.|:..|..||  ..|||..
  Fly   365 HSHSH-------------------GYGL---LNDYP---QQQTHQQYDAYPQQYQHQCSYQQHPQ 404

  Fly   196 DPIH 199
            |..|
  Fly   405 DLYH 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 20/55 (36%)
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 20/55 (36%)
KLF1_2_4_N <321..404 CDD:425360 31/124 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.