DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and si:dkey-43p13.5

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_068074401.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:285 Species:Danio rerio


Alignment Length:86 Identity:46/86 - (53%)
Similarity:62/86 - (72%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
            ||||.|..:::.||:|||:.||.|||||:|.||.||:|:||.||||||||||||||.|:|.|:..
Zfish   110 KQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEARVQVWFQNRRAKMRRQLKLQI 174

  Fly    74 LGGDYKEGALDLDVSYDDSAV 94
            ..|: :....|.|..:.:|::
Zfish   175 QTGE-QCSQRDTDTRHPESSI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 37/55 (67%)
si:dkey-43p13.5XP_068074401.2 None

Return to query results.
Submit another query.