DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and phox2a

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_996953.2 Gene:phox2a / 404602 ZFINID:ZDB-GENE-000223-14 Length:280 Species:Danio rerio


Alignment Length:209 Identity:78/209 - (37%)
Similarity:98/209 - (46%) Gaps:33/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            ||||||.||||.:.||:||||.|..|||||::.|||||::||||||||||||||||||:||||:.
Zfish    89 KRKQRRIRTTFTSSQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERA 153

  Fly    72 GGLGGDYKEGA---LDLDVSYDDSAVLGQLDSALGGGGTLLPD-TPPQSSNSLDNELKASYGTG- 131
            .........|.   .|...|.:|       |.:.....:..|| |...||....:.|..|...| 
Zfish   154 ANSKASSSSGGKKPSDARSSSED-------DESKESTCSPTPDSTANMSSPGARSSLSPSPAPGP 211

  Fly   132 --AMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHA 194
              ..||:.:||.:                 .|..|.:....|...||..  :...|:...|....
Zfish   212 ASTFSPASISPAL-----------------KSSPWPSLGSGTPGPTHTH--TQELLKAWQPADSM 257

  Fly   195 SDPIHAGSSSHHQQ 208
            |.|.....||.|::
Zfish   258 SGPFAGVLSSFHRK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
phox2aNP_996953.2 Homeobox 96..148 CDD:306543 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4900
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.