DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and cdx4

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_989417.1 Gene:cdx4 / 395056 XenbaseID:XB-GENE-482787 Length:260 Species:Xenopus tropicalis


Alignment Length:71 Identity:27/71 - (38%)
Similarity:42/71 - (59%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRK--QEK 70
            |.:.:||..:...|..|||:.|..:.|..:..:.|||..:.|:|.:|::||||||||.||  ::|
 Frog   150 RTKEKYRVVYTDHQRLELEKEFHYSRYITIRRKTELAASLRLSERQVKIWFQNRRAKERKLFKKK 214

  Fly    71 IGGLGG 76
            :....|
 Frog   215 MNQFDG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 22/55 (40%)
cdx4NP_989417.1 Caudal_act 16..147 CDD:461413
Homeodomain 154..209 CDD:459649 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.