Sequence 1: | NP_477330.1 | Gene: | Pph13 / 33239 | FlyBaseID: | FBgn0023489 | Length: | 357 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524041.2 | Gene: | toe / 39418 | FlyBaseID: | FBgn0036285 | Length: | 640 | Species: | Drosophila melanogaster |
Alignment Length: | 272 | Identity: | 74/272 - (27%) |
---|---|---|---|
Similarity: | 106/272 - (38%) | Gaps: | 80/272 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
Fly 74 L------------------------------------GGDYKEGALDLDVSYDDSAVLGQLDSA- 101
Fly 102 -------LGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGS- 158
Fly 159 ----GLSMEWSTYP-PQTQAQTHPQMDSDNQLQQHPPQQ--------HASDPIHAGSSSHHQQQQ 210
Fly 211 QQHQQEQHNPQL 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pph13 | NP_477330.1 | Homeobox | 14..66 | CDD:278475 | 33/51 (65%) |
toe | NP_524041.2 | HTH | 134..230 | CDD:304362 | |
Homeobox | 388..440 | CDD:278475 | 33/51 (65%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450821 | |
Domainoid | 1 | 1.000 | 55 | 1.000 | Domainoid score | I4097 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |