DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and toe

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_524041.2 Gene:toe / 39418 FlyBaseID:FBgn0036285 Length:640 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:106/272 - (38%) Gaps:80/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
            |.||.||||:..||.|||:.|.::|||.|..||:||.|..|:||||||||.|||||||:.:::..
  Fly   383 KFRRNRTTFSPEQLDELEKEFDKSHYPCVNTREKLAARTALSEARVQVWFSNRRAKWRRHQRVNL 447

  Fly    74 L------------------------------------GGDYKEGALDLDVSYDDSAVLGQLDSA- 101
            :                                    .|..|:     ...|..|.:.....|: 
  Fly   448 IKQRDSPSTSSSPTPLVNPVVSPVSPIPVPVPVAVPESGQQKQ-----PYPYSTSNMCNTSSSSS 507

  Fly   102 -------LGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGS- 158
                   :..|..:...|...|||....|..|:..|.  ||:..:|            |..||. 
  Fly   508 NSQPCNTINPGSKMSSKTSSVSSNQHMEEPAAAVATA--SPTASAP------------LSMGGEN 558

  Fly   159 ----GLSMEWSTYP-PQTQAQTHPQMDSDNQLQQHPPQQ--------HASDPIHAGSSSHHQQQQ 210
                .|.|   |.| |.|.........:.:..:|:..:.        |.|.||.|.|...||.::
  Fly   559 SAFRALPM---TLPMPMTLPTASAAAFALSFARQYIAKYMGTPLNLGHGSSPIQAQSGRDHQSEE 620

  Fly   211 QQHQQEQHNPQL 222
            ::::.||...::
  Fly   621 REYEDEQEEEEV 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 33/51 (65%)
toeNP_524041.2 HTH 134..230 CDD:304362
Homeobox 388..440 CDD:278475 33/51 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450821
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.