DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and shox2

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_957490.1 Gene:shox2 / 394171 ZFINID:ZDB-GENE-040426-1457 Length:299 Species:Danio rerio


Alignment Length:127 Identity:58/127 - (45%)
Similarity:67/127 - (52%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |:...|.||||.||.|...||.||||.|..|||||.|.||||:.|:.|:||||||||||||||.|
Zfish   100 DETQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCR 164

  Fly    67 KQEK------IGGLGGDYKE---------GALDLDVSYDD-----------SAVLGQLDSAL 102
            |||.      :.|....::.         |||.:....|.           .|.| |||||:
Zfish   165 KQENQLHKGVLIGAASQFEACRVAPYVNVGALRMPFQQDSHCNVPPFSFQVQAQL-QLDSAV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 38/55 (69%)
shox2NP_957490.1 Homeodomain 109..165 CDD:459649 38/55 (69%)
OAR 278..295 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.