| Sequence 1: | NP_477330.1 | Gene: | Pph13 / 33239 | FlyBaseID: | FBgn0023489 | Length: | 357 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
| Alignment Length: | 34 | Identity: | 7/34 - (20%) |
|---|---|---|---|
| Similarity: | 13/34 - (38%) | Gaps: | 10/34 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 TGTAGDALNYHKDMKFSTVDRDNDVSTTHCARYW 93 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pph13 | NP_477330.1 | Homeodomain | 11..67 | CDD:459649 | 3/6 (50%) |
| Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | |
| LIM | 333..388 | CDD:413332 | |||
| Homeodomain | 425..481 | CDD:459649 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||