DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Lmx1a

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster


Alignment Length:34 Identity:7/34 - (20%)
Similarity:13/34 - (38%) Gaps:10/34 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TGTAGDALNYHKDMKFSTVDRDNDVSTTHCARYW 93
            :.|||:.          :|.:..|.:..:|...|
  Fly   116 SNTAGNL----------SVSKGTDNTADNCIEIW 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 3/6 (50%)
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:413332
Homeodomain 425..481 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.