DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Rhox12

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001020254.1 Gene:Rhox12 / 382282 MGIID:2685994 Length:186 Species:Mus musculus


Alignment Length:65 Identity:27/65 - (41%)
Similarity:42/65 - (64%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEK 70
            ::|.:.|.:..|...||.|||..|::|.|||...|:.||..:.|.|::||.||:.|||.:||:::
Mouse   106 VRRTRPRIQLGFTPRQLNELEDFFEKTKYPDALTRKNLAKHLYLAESKVQRWFKKRRAHYRKEQQ 170

  Fly    71  70
            Mouse   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/55 (44%)
Rhox12NP_001020254.1 homeodomain 107..169 CDD:238039 27/61 (44%)

Return to query results.
Submit another query.