DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and gsb

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:109/272 - (40%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQ-- 68
            :||||||.||||:..|:..|||.|.||.||||:.|||||....||||||||||.||||:.|||  
  Fly   181 LKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLN 245

  Fly    69 -----------EKIGGLGGDYKEGALDLDVSYDDS---AVLGQLDSALGGGGTLLPDTPPQSSNS 119
                       ...|.........|.::.:|...|   ...|..::....||::...:|..|::.
  Fly   246 TQQVPSFAPTSTSFGATPTTSAAPAPNMGMSLYSSQSWPSSGAYENHAAYGGSVASMSPASSTSG 310

  Fly   120 LDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYP------PQTQAQTHPQ 178
            ..:...:...|.|..|...|.  |:....          |:....:|||      |||.|.:..|
  Fly   311 TSSAAHSPVQTQAQQPGTGSE--FMTSTY----------GVGSSNATYPSAAYSMPQTPATSAEQ 363

  Fly   179 MDSDNQLQQHPPQQHASDPIHAGSSSHHQQQQQQHQQEQHNPQLHPGLEFAASLSLDMTDGSSAY 243
            :.|          |.||   .|.|.|||             |.......||.|.   ....|:|.
  Fly   364 LRS----------QFAS---AAASGSHH-------------PSTWDSYNFAGSF---FPPASAAG 399

  Fly   244 DEMKFLSVDVDQ 255
            :.:......|||
  Fly   400 NHISGYHHQVDQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 34/51 (67%)
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 37/56 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450979
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.