DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and gsb-n

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:290 Identity:85/290 - (29%)
Similarity:109/290 - (37%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEK 70
            :||||||.||||...||:.|||||.||.||||:.|||||....|||||:||||.||||:.||.. 
  Fly   178 LKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHS- 241

  Fly    71 IGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSP 135
                                            ||..:.|   .|.:|.|      ::.|.|....
  Fly   242 --------------------------------GGSNSGL---SPMNSGS------SNVGVGVGLS 265

  Fly   136 SRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHASDPIHA 200
            ...:|          ||....|.|....:|..|..|  .|...|:.......|.|..|.|....|
  Fly   266 GATAP----------LGYGPLGVGSMAGYSPAPGTT--ATGAGMNDGVHHAAHAPSSHHSAATAA 318

  Fly   201 GSSSHHQQQQQQHQQEQHNPQLHPGLEFAASLSLDMTDGSSA----YDEMKFLSVDVDQFTIDSF 261
            .::.||.|.              .|.:...|.:.....|..|    :....:...|..:.|||.|
  Fly   319 AAAHHHTQM--------------GGYDLVQSAAQHGFPGGFAQPGHFGSQNYYHQDYSKLTIDDF 369

  Fly   262 K---ADCILSMEQSQMQAYGGHSQLVGSSN 288
            .   ||.:..:..| :.....:|:|...||
  Fly   370 SKLTADSVSKISPS-LHLSDNYSKLEAPSN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 35/51 (69%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450982
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.