DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Rx

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster


Alignment Length:386 Identity:111/386 - (28%)
Similarity:151/386 - (39%) Gaps:91/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |....|:|.||.||||.|.||.||||||:::|||||:.|||||::::|.|.||||||||||||||
  Fly   551 DDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWR 615

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYDDSAVLG-----QLDSALGGGGTLLPDTP---PQSSNSLDNE 123
            :|||                   .:|..||     ||...||.|.:.||..|   |...::|...
  Fly   616 RQEK-------------------SESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGF 661

  Fly   124 LKASYGTGAMSPSRLSPNIFL---NLNID-----------------HLGLERGGSGLSMEWSTYP 168
            |....   .:.||.|:|.:.|   ||.:.                 |:|  .||.|  ......|
  Fly   662 LSHPQ---TVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVG--HGGHG--QPQPPPP 719

  Fly   169 PQTQAQTHPQMDSDNQLQQHPPQQHASDPIHAGSSSH---HQQQQQQHQQEQHNPQ--------- 221
            |......||               |.|.  |....||   |..:...|.....:|.         
  Fly   720 PPPHGVPHP---------------HGSH--HVVPLSHLSPHLSRMSPHATSLGSPHHGVTPLGTP 767

  Fly   222 LH---PGLEFAASLSLDMTDGSSAYDEMKFLSVDV----DQFTIDSFKADCILSMEQSQMQAYGG 279
            ||   |....|.::::..:..||:...::....||    ...:|.:..::.......|.:.| |.
  Fly   768 LHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLDA-GS 831

  Fly   280 HSQLVGSSNELCLDGIGMSSFGMEEGEPKSPPSLLVLDKSLPSLSIGVEGIADLVEQLHHH 340
            .|...|||.:.|.....:....:....|..||:......|.|...:....||.|..:...|
  Fly   832 TSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEH 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 37/51 (73%)
RxNP_726006.3 Homeobox 563..615 CDD:278475 37/51 (73%)
OAR 876..892 CDD:281777 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.