DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and otp

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:258 Identity:90/258 - (34%)
Similarity:123/258 - (47%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |:...|.||:|:||.|...||.||||.|.:|||||:|.|||:|:||.|||:|||||||||||||:
  Fly   108 DQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWK 172

  Fly    67 KQEKI-------GGL---GGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQS----- 116
            |::|.       |.|   .|....||...:::..|    |...:.:.||........|.:     
  Fly   173 KRKKTTNVFRTPGALLPSHGLPPFGANITNIAMGD----GLCGTGMFGGDRWSVGVNPMTAGFGQ 233

  Fly   117 ---SNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLG----LERGGSGLSMEWSTYPPQTQAQ 174
               |:.|.:.|.:...:|....|.|....:.:..::.||    .:....|:|...|..|   .|.
  Fly   234 LNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLNALGDSMMYQHSVGGVSCGPSGSP---SAT 295

  Fly   175 THPQMDSDNQLQQHPPQQHASDPIHAGSSS------------HHQQQQQQHQ-QEQHNPQLHP 224
            |.|.|:|.:.:.  ||      |:.|..:|            |.|||||.|| |:|...|.||
  Fly   296 TPPNMNSCSSVT--PP------PLSAQPNSSQNELNGEPMPLHQQQQQQTHQHQQQQTHQHHP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 37/51 (73%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 32/47 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450946
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.