DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Alx3

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001007013.2 Gene:Alx3 / 365900 RGDID:1359270 Length:343 Species:Rattus norvegicus


Alignment Length:320 Identity:102/320 - (31%)
Similarity:129/320 - (40%) Gaps:130/320 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKW 65
            |:....|.|:||.||||:|.||:|||:.||:||||||:.||:||:|.||||||||||||||||||
  Rat   144 MELAKSKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKW 208

  Fly    66 RKQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLP--DTPPQSSNSLDNELKASY 128
            ||:|:.|.:    :||......:||.|               :||  |:.||    |.|.|.:|.
  Rat   209 RKRERYGKI----QEGRNPFTTAYDIS---------------VLPRTDSHPQ----LQNSLWSSP 250

  Fly   129 GTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQH 193
            |:|       ||               ||..|      .||  :....|.|.         |..|
  Rat   251 GSG-------SP---------------GGPCL------MPP--EGIPSPCMS---------PYSH 276

  Fly   194 ASDPIHAGSSSHHQQQQQQHQQEQHNPQLHPGLEFAASLSLDMTDGSSAYDEMKFLSVDVDQFTI 258
            :...: ||           ......:|..|||:                             ::|
  Rat   277 SHGNV-AG-----------FMGVPASPAAHPGI-----------------------------YSI 300

  Fly   259 DSFKADCILSMEQSQMQAYGGHSQLVGSSNELCLDG----IGMSSFGMEEGEPKSPPSLL 314
            ..|.            .|.|||      |.|...||    ..:.|..|   :||.|||||
  Rat   301 HGFP------------PALGGH------SFEPSPDGDYKSPSLVSLRM---KPKEPPSLL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 40/51 (78%)
Alx3NP_001007013.2 Homeobox 157..210 CDD:395001 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45998
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X469
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.