DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and PDX1

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens


Alignment Length:194 Identity:53/194 - (27%)
Similarity:71/194 - (36%) Gaps:82/194 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
            :.:|.||.:...||.|||:.|....|.....|.||||.::|||..:::||||||.||:|:|    
Human   145 ENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEE---- 205

  Fly    74 LGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGT----------------LLPDTPPQSSNSLDN 122
               |.|.|.                .:|:||||.                .||..||..      
Human   206 ---DKKRGG----------------GTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPG------ 245

  Fly   123 ELKASYGTGAMSPS--------RLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQ 178
                    ||:.|:        ||.|                  |||   ::..|.:.|...||
Human   246 --------GAVPPAAPVAAREGRLPP------------------GLS---ASPQPSSVAPRRPQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 26/55 (47%)
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71
Antp-type hexapeptide 118..123
Homeodomain 147..203 CDD:459649 26/55 (47%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 28/138 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.