powered by:
Protein Alignment Pph13 and Rhox12
DIOPT Version :9
Sequence 1: | NP_477330.1 |
Gene: | Pph13 / 33239 |
FlyBaseID: | FBgn0023489 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020072.1 |
Gene: | Rhox12 / 363437 |
RGDID: | 1563789 |
Length: | 175 |
Species: | Rattus norvegicus |
Alignment Length: | 64 |
Identity: | 27/64 - (42%) |
Similarity: | 40/64 - (62%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEK 70
:|.:.|.:......||.|||..|:.|.||||..|..||..:.|.|:||:.||:.|||::||:::
Rat 101 RRTRPRIQLGLTPRQLSELEDFFETTKYPDVITRRNLAKHLYLAESRVKRWFKRRRARYRKEQQ 164
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.