DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and eve

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:344 Identity:74/344 - (21%)
Similarity:110/344 - (31%) Gaps:135/344 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGGLG 75
            |||||.|...||..||:.|.:.:|.....|.|||.:::|.|:.::|||||||.|.::|.      
  Fly    71 RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR------ 129

  Fly    76 GDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSRLSP 140
                     :.|::..:||                                 |...|.:.|.   
  Fly   130 ---------IAVAWPYAAV---------------------------------YSDPAFAASI--- 149

  Fly   141 NIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQA--------QTHPQMDSDNQLQQHPPQQHASDP 197
                        |:...:.:.|.:..|.|...|        .|:|.|.:.......|.......|
  Fly   150 ------------LQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPMMATGMPPMGMPQMPTMQMP 202

  Fly   198 IHAGSSSHHQQQQQQHQQEQHNP------------QLHPGLEFAASLSLDMTDGSSAYDEMKFLS 250
            .|:|.:.|.....|......|.|            ..||.:.           ||||        
  Fly   203 GHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHHPHMM-----------GSSA-------- 248

  Fly   251 VDVDQFTIDSFKADCILSMEQSQMQAYGGHSQLVGS-SNELCLDGIGMSSFGMEEGEPKS-PPSL 313
                  |..|:.|               |.:.|:|: .:..|..|:|:       |.||: .|.|
  Fly   249 ------TGSSYSA---------------GAAGLLGALPSATCYTGLGV-------GVPKTQTPPL 285

  Fly   314 LVLDKSLP---SLSIGVEG 329
            .:...|.|   :||:...|
  Fly   286 DLQSSSSPHSSTLSLSPVG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 23/51 (45%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451009
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.