DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and prd

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:416 Identity:118/416 - (28%)
Similarity:157/416 - (37%) Gaps:146/416 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEK 70
            :||||||.||||:..||.||||||:||.|||::.|||||.|.:|||||:||||.||||:.|||..
  Fly   209 LKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQHT 273

  Fly    71 --IGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGG----------GGTLLPDTPPQSSNSLDNE 123
              .||..|    ||.   .|....|....|.|.:..          .|:|.|.|..|.....   
  Fly   274 SVSGGAPG----GAA---ASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQYDF--- 328

  Fly   124 LKASYGTGA---------MSPSRLSPNI---------FLNLNIDHLGL----ERG-----GSGLS 161
                ||:.|         |:.|.|||.|         |.|.:.:....    |.|     |:.:.
  Fly   329 ----YGSHANISVSAAAPMASSNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIV 389

  Fly   162 MEWST-----YPPQTQA-QTHPQMDSDNQ-----LQQHPPQQHASDPIHAG----SSSHHQQQQQ 211
            ..:.|     |..:|:. ||.|:.:|.|:     ..|.||..::...:.:|    |||       
  Fly   390 SSYETQLGSVYGTETETHQTMPRNESPNESVSSAFGQLPPTPNSLSAVVSGAGVTSSS------- 447

  Fly   212 QHQQEQHNPQLHPGLEFAASLSLDMTDGSSAYDE----MKFLSVDVDQFTIDSFKADCILSMEQS 272
                         |....|..|..:.:.|:..:|    :|..|||:               :..|
  Fly   448 -------------GANSGADPSQSLANASAGSEELSAALKVESVDL---------------IAAS 484

  Fly   273 QMQAYGGHSQLVGSSNELCLDGIGMSSFGMEEGEPKSPPSLLVLDKSLPSLSIGVEGIADLVEQL 337
            |.|.|||.|                   .|:...|.:|   |..:.||.|.|...:.:.....|:
  Fly   485 QSQLYGGWS-------------------SMQALRPNAP---LSPEDSLNSTSSTSQALDVTAHQM 527

  Fly   338 HH-----------------HQHEGGP 346
            .|                 |.|.|.|
  Fly   528 FHPYQHTPQYASYPAPGHAHSHHGHP 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 36/51 (71%)
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 36/51 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450985
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.