DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and al

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:275 Identity:94/275 - (34%)
Similarity:124/275 - (45%) Gaps:76/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |:...|||||||||||.:.||:|||:||.||||||||.|||||::|.|||||:||||||||||||
  Fly    77 DEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWR 141

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDT-----PPQSSNSLDNELK- 125
            ||||:|.....|                    :..|.||...:...     ||.....|..:|: 
  Fly   142 KQEKVGPQSHPY--------------------NPYLPGGAATMQTVVGAALPPNPFTHLGFQLRK 186

  Fly   126 ----------ASYGTGAMSPSRLSPNIFLN---LNIDHLGLERGGSGLSMEWSTYPPQTQAQT-- 175
                      |::....:|.:.:.|:.:.|   ....|: |..|.:|:      |.|.:..|:  
  Fly   187 PFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHM-LPHGMAGM------YSPSSSFQSLL 244

  Fly   176 ---------------------HPQMDSDNQLQQHPPQQHASDPIHAGSSSHHQQQQQQH-QQEQH 218
                                 .|.:.|.|.:...||...||     |.:|.|||....| ...|.
  Fly   245 ANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPAS-----GHASQHQQHPTAHPPPPQA 304

  Fly   219 NPQLHPGLEFAASLS 233
            .||:..|:: .|.||
  Fly   305 PPQMPVGVQ-PAQLS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 40/51 (78%)
alNP_722629.1 Homeobox 89..141 CDD:278475 40/51 (78%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451206
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 1 0.900 - - E33208_3BSUU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.