DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and CG32532

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster


Alignment Length:229 Identity:69/229 - (30%)
Similarity:92/229 - (40%) Gaps:62/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGGL 74
            :||:||||...||.|||.||.::||||::.|||||....|.|||:||||||||||:|||||    
  Fly   510 RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEK---- 570

  Fly    75 GGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAM------ 133
                                  ||..||.      |...|..:..:.|....|...|..      
  Fly   571 ----------------------QLQKALA------PSVIPSCNGMMRNIQGYSVSRGYQPYPHHN 607

  Fly   134 SPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQ--AQTH-PQMDSDNQLQQHPPQQHAS 195
            :.:|...::|                 .|..|:||..||  :..| ..|.|....|....:.|..
  Fly   608 TMNRYPQDLF-----------------QMGASSYPGMTQPFSMAHSTNMGSVGVRQDSMGEFHGM 655

  Fly   196 DPIHAGSSSHHQQQQQQHQQEQHNPQLH-PGLEF 228
            .|   ....:::..........|:|.|. |.|::
  Fly   656 SP---EDEWYNKSLSALRMNSSHHPNLSAPMLQY 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 34/51 (67%)
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450866
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.