DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HOXC5

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:61 Identity:24/61 - (39%)
Similarity:36/61 - (59%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            :|.||::...|..|||:.|....|.....|.|:|..:.|.|.::::||||||.||:|..|:
Human   156 KRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKM 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 22/55 (40%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141
Antp-type hexapeptide 140..145
Homeodomain 156..212 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.