DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HOXB7

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens


Alignment Length:72 Identity:29/72 - (40%)
Similarity:43/72 - (59%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQ 68
            ||.:::.|:..|.:.||   |||:.|....|.....|.|:|..:.|||.::::||||||.||:|:
Human   134 GTDRKRGRQTYTRYQTL---ELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKE 195

  Fly    69 EKIGGLG 75
            .|..|.|
Human   196 NKTAGPG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
HOXB7NP_004493.3 Antp-type hexapeptide 126..131
Homeodomain 138..194 CDD:459649 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.