DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HOXB4

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:73 Identity:27/73 - (36%)
Similarity:40/73 - (54%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI---- 71
            :|.||.:...|:.|||:.|....|.....|.|:|..:.|:|.::::||||||.||:|..|:    
Human   163 KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTK 227

  Fly    72 ---GGLGG 76
               ||..|
Human   228 IRSGGAAG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 22/55 (40%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134
Antp-type hexapeptide 141..146
Homeodomain 163..219 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.