DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HOXA5

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:74 Identity:26/74 - (35%)
Similarity:41/74 - (55%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGGL- 74
            :|.||.:...|..|||:.|....|.....|.|:|..:.|:|.::::||||||.||:|..|:..: 
Human   196 KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMS 260

  Fly    75 ----GGDYK 79
                ||.::
Human   261 MAAAGGAFR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 22/55 (40%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175
Antp-type hexapeptide 176..181
Homeodomain 196..252 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.