DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HOXA3

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_109377.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:266 Identity:61/266 - (22%)
Similarity:92/266 - (34%) Gaps:93/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGGL- 74
            :|.||.:.:.||.|||:.|....|.....|.|:|..::|||.::::||||||.|::|.:|..|: 
Human   192 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGML 256

  Fly    75 ----------------GGDYKEGALDL--DVSYD------------------DSAVLGQLDS--- 100
                            .|.|......|  .|.|:                  .::....|.|   
Human   257 TSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKPPQGTYGLPPASYPASLPSCAP 321

  Fly   101 -----------ALGGGGTLLPDTPPQSSNSLDNELKASYGTGAM--SP-----------SRLSPN 141
                       ..|.|||  ||..|.:.....|   .||||..:  ||           |...|.
Human   322 PPPPQKRYTAAGAGAGGT--PDYDPHAHGLQGN---GSYGTPHIQGSPVFVGGSYVEPMSNSGPA 381

  Fly   142 IFLNLNIDHL---GLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHASDPIHAGSS 203
            :|...::.|.   .::.||:|                  .:.|.:.....|.:.|   |.:...:
Human   382 LFGLTHLPHAASGAMDYGGAG------------------PLGSGHHHGPGPGEPH---PTYTDLT 425

  Fly   204 SHHQQQ 209
            .||..|
Human   426 GHHPSQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
HOXA3NP_109377.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147
Antp-type hexapeptide 155..160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 1/3 (33%)
Homeodomain 192..248 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 11/90 (12%)
DUF4074 377..441 CDD:463833 13/76 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.