DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and oc

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster


Alignment Length:396 Identity:92/396 - (23%)
Similarity:143/396 - (36%) Gaps:95/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQ 68
            |...|||||.||||...||..||..|.:|.|||:|.|||:|::|:|.|:||||||:|||||.|:|
  Fly    61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125

  Fly    69 EKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQS-------SNSLDNELKA 126
                            |......:::....:::.||.|.....:...|       .:|.:|..::
  Fly   126 ----------------LQQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQS 174

  Fly   127 SYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQ 191
            |.|..:...|:...|       .....:.|||......:.......|.....:.:...::.|   
  Fly   175 SGGNNSNKSSQKQGN-------SQSSQQGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTH--- 229

  Fly   192 QHASDPIHAGSSSHHQQQQQQHQQEQHNPQ---------------LHPGLEFAASLSLDMTDGSS 241
             |:|....|.:::.....|..:....:|.|               ...|...:|:.:....:.::
  Fly   230 -HSSFLSAAAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLSAAAAAAALNVTA 293

  Fly   242 AYDEMKFLSVDVDQFTIDSFKADCILSMEQSQMQAYGGHSQLVGSSNELCLDGIGMSSFGMEEGE 306
            |:.....| :.....::......|      .:....||:...||...    .|.|.||.|:..|.
  Fly   294 AHQNSSPL-LPTPATSVSPVSIVC------KKEHLSGGYGSSVGGGG----GGGGASSGGLNLGV 347

  Fly   307 PKSPPSLLVLDKSLPSLSIGVEGIADLV----EQL------------HHHQHEGGPVG------- 348
            ...           ..:.:||....||:    :||            |||...|...|       
  Fly   348 GVG-----------VGVGVGVGVSQDLLRSPYDQLKDAGGDIGAGVHHHHSIYGSAAGSNPRLLQ 401

  Fly   349 -GGVIT 353
             ||.||
  Fly   402 PGGNIT 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 32/51 (63%)
ocNP_001356934.1 Homeobox 71..123 CDD:333795 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451015
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.