DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and arxa

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_571459.1 Gene:arxa / 30657 ZFINID:ZDB-GENE-990415-15 Length:453 Species:Danio rerio


Alignment Length:256 Identity:98/256 - (38%)
Similarity:123/256 - (48%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ::|.:|||||||||||.:.||:|||||||:|||||||.|||||:|:|||||||||||||||||||
Zfish   207 EEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 271

  Fly    67 KQEKIG------GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELK 125
            |:||.|      ||.   ..|.|         |....|...|.||     ..||....:|::...
Zfish   272 KREKAGVQAHPTGLP---FPGPL---------AAAHPLSHYLEGG-----PFPPHPHPALESAWT 319

  Fly   126 ASYGTGAMSP--------SRLSPNIFLNLNIDHLGLERG------GSGLSMEWSTYPPQTQA--- 173
            |:....|..|        |.|.|...|.|. ..||....      |......:|:..|.|.|   
Zfish   320 AAAAAAAAFPGLAPPPNSSALPPATPLGLG-TFLGTAMFRHPAFIGPTFGRLFSSMGPLTSASTA 383

  Fly   174 -----QTHPQMDSDNQLQQHPPQQHASDPIHAGSSSHHQQQQQ-------QHQQEQHNPQL 222
                 ||.|.::|       |.|..|:.|....|||.....::       :.:.::|:.||
Zfish   384 AALLRQTAPPVES-------PVQPSAALPEPPSSSSSTAADRRASSIAALRLKAKEHSAQL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 43/51 (84%)
arxaNP_571459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212 1/4 (25%)
Homeobox 219..271 CDD:278475 43/51 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..418 10/34 (29%)
OAR 417..434 CDD:281777 0/16 (0%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 421..434 0/12 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BSUU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.