DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and dbx1b

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:110 Identity:37/110 - (33%)
Similarity:59/110 - (53%) Gaps:23/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TMKRKQRR---YRTTFNTLQLQELERAFQRTHY---PDVFFREELAVRIDLTEARVQVWFQNRRA 63
            |.:.|.||   .|..|:.:|.:.||:.||:..|   ||   |::||.::.|.:::|::||||||.
Zfish   171 TARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPD---RKKLATKLGLKDSQVKIWFQNRRM 232

  Fly    64 KWR--KQEKIGGLGGDYKEGAL-----------DLDVSYDDSAVL 95
            |||  |:.::...|| .:|..|           |:...::..|||
Zfish   233 KWRNSKERELLSSGG-CREQTLPTKMNPNPDLSDVGKRFEHEAVL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 26/63 (41%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 36/108 (33%)
Homeodomain 182..236 CDD:459649 23/56 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.