DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and hoxa11b

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_571222.1 Gene:hoxa11b / 30382 ZFINID:ZDB-GENE-990415-4 Length:283 Species:Danio rerio


Alignment Length:60 Identity:23/60 - (38%)
Similarity:39/60 - (65%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRK 67
            :|.|:.|..:...|::||||.|..:.|.:...|.:|:..::||:.:|::||||||.|.:|
Zfish   209 QKTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 21/55 (38%)
hoxa11bNP_571222.1 DUF3528 26..151 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..215 2/5 (40%)
Homeodomain 212..268 CDD:459649 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.