DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Cdx4

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001100412.1 Gene:Cdx4 / 302400 RGDID:1561529 Length:288 Species:Rattus norvegicus


Alignment Length:136 Identity:38/136 - (27%)
Similarity:58/136 - (42%) Gaps:44/136 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            |.:.:||..:...|..|||:.|....|..:..:.||||.:.|:|.:|::||||||||.||..|  
  Rat   175 RTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKMIK-- 237

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSR 137
                                ..:.|.:::   ||::..|                  :|::||..
  Rat   238 --------------------KKISQFENS---GGSVQSD------------------SGSISPGE 261

  Fly   138 LSPNIF 143
            | ||.|
  Rat   262 L-PNAF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
Cdx4NP_001100412.1 Caudal_act 13..174 CDD:461413
Homeodomain 179..234 CDD:459649 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.