DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and RAX

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_038463.2 Gene:RAX / 30062 HGNCID:18662 Length:346 Species:Homo sapiens


Alignment Length:236 Identity:81/236 - (34%)
Similarity:99/236 - (41%) Gaps:66/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            |:|.||.||||.|.||.||||||:::|||||:.|||||.:::|.|.||||||||||||||:|||:
Human   133 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKL 197

  Fly    72 ------------------------------GGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGG 106
                                          .|.||....|||.|:      :.||  ....|||.
Human   198 EVSSMKLQDSPLLSFSRSPPSATLSPLGAGPGSGGGPAGGALPLE------SWLG--PPLPGGGA 254

  Fly   107 TLLPDT----PPQSSNSLDNELKASYGTGAMSPSRL-SPNIFLNLNIDHLGLERGGSGLSMEWST 166
            |.|...    ||..|      |.|||......|..| ||.:              |.||.   ..
Human   255 TALQSLPGFGPPAQS------LPASYTPPPPPPPFLNSPPL--------------GPGLQ---PL 296

  Fly   167 YPPQTQAQTHPQMDSDNQLQQHPPQQHASDPIHAGSSSHHQ 207
            .||.......|.......|.:..|:..:...:...:..|.|
Human   297 APPPPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 37/51 (73%)
RAXNP_038463.2 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..145 8/11 (73%)
Homeobox 140..192 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..318 35/154 (23%)
OAR 319..335 CDD:281777 1/15 (7%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 323..336 0/12 (0%)
Nuclear localization signal. /evidence=ECO:0000255 329..333 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.