Sequence 1: | NP_477330.1 | Gene: | Pph13 / 33239 | FlyBaseID: | FBgn0023489 | Length: | 357 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038463.2 | Gene: | RAX / 30062 | HGNCID: | 18662 | Length: | 346 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 81/236 - (34%) |
---|---|---|---|
Similarity: | 99/236 - (41%) | Gaps: | 66/236 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
Fly 72 ------------------------------GGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGG 106
Fly 107 TLLPDT----PPQSSNSLDNELKASYGTGAMSPSRL-SPNIFLNLNIDHLGLERGGSGLSMEWST 166
Fly 167 YPPQTQAQTHPQMDSDNQLQQHPPQQHASDPIHAGSSSHHQ 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pph13 | NP_477330.1 | Homeobox | 14..66 | CDD:278475 | 37/51 (73%) |
RAX | NP_038463.2 | Octapeptide motif | 33..40 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 46..145 | 8/11 (73%) | |||
Homeobox | 140..192 | CDD:278475 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..318 | 35/154 (23%) | |||
OAR | 319..335 | CDD:281777 | 1/15 (7%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 323..336 | 0/12 (0%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 329..333 | 0/3 (0%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |