DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Alx4

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001100023.1 Gene:Alx4 / 296511 RGDID:1310201 Length:399 Species:Rattus norvegicus


Alignment Length:185 Identity:66/185 - (35%)
Similarity:94/185 - (50%) Gaps:41/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |..:.|.|:||.||||.:.||:|||:.||:||||||:.||:||:|.|||||||||||||||||||
  Rat   194 DSESSKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWR 258

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYD-------DSAVLGQLDSALGGGGTLLP-------------- 110
            |:|:.|.:    ::.......:|:       ::....|..|.:|..|...|              
  Rat   259 KRERFGQM----QQVRTHFSTAYELPLLTRAENYAQIQNPSWIGNNGAASPVPACVVPCDPVPAC 319

  Fly   111 ----DTPPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLS 161
                ..||.|..|..::..:..|.|:            ::...|:|...|.:|:|
  Rat   320 MSPHAHPPGSGASSVSDFLSVSGAGS------------HVGQTHMGSLFGAAGIS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
Alx4NP_001100023.1 Homeobox 206..258 CDD:278475 39/51 (76%)
OAR 375..392 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45998
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X469
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.