DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Uncx

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_058875.2 Gene:Uncx / 29375 RGDID:69361 Length:530 Species:Rattus norvegicus


Alignment Length:203 Identity:67/203 - (33%)
Similarity:86/203 - (42%) Gaps:67/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ||.:...|:||.||.|...||:|||:||..:||||||.||.||:|:||.|:||||||||||||||
  Rat   101 DKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWR 165

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSL----------- 120
            |:|       :.|:|                            |..|..:|:..           
  Rat   166 KKE-------NTKKG----------------------------PGRPAHNSHPTTCSGEPMDPEE 195

  Fly   121 ----------------DNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPP 169
                            :.:|..|......||..||.:...:.:.|     .||.|||.|....||
  Rat   196 IARKELEKMEKKKRKHEKKLLKSQSRHLHSPGGLSLHSAPSSDSD-----SGGGGLSPEPPEPPP 255

  Fly   170 QTQAQTHP 177
            .|.:...|
  Rat   256 PTASAKGP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 39/55 (71%)
UncxNP_058875.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111 3/9 (33%)
Homeodomain 110..166 CDD:459649 39/55 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..362 25/139 (18%)
PHA03247 <289..524 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.