DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ALX3

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:143 Identity:70/143 - (48%)
Similarity:89/143 - (62%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKW 65
            |:....|.|:||.||||:|.||:|||:.||:||||||:.||:||:|.||||||||||||||||||
Human   144 MELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKW 208

  Fly    66 RKQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLP--DTPPQSSNSLDNELKASY 128
            ||:|:.|.:    :||......:||.|               :||  |:.||    |.|.|.||.
Human   209 RKRERYGKI----QEGRNPFTAAYDIS---------------VLPRTDSHPQ----LQNSLWASP 250

  Fly   129 GTGAM-SPSRLSP 140
            |:|:. .|..:||
Human   251 GSGSPGGPCLVSP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 40/51 (78%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
PRK12323 <13..131 CDD:237057
Homeobox 157..210 CDD:365835 41/52 (79%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41860
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 1 1.000 - - X469
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.