powered by:
Protein Alignment Pph13 and Rhox11
DIOPT Version :9
Sequence 1: | NP_477330.1 |
Gene: | Pph13 / 33239 |
FlyBaseID: | FBgn0023489 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_941000.1 |
Gene: | Rhox11 / 194738 |
MGIID: | 2681831 |
Length: | 206 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 27/66 - (40%) |
Similarity: | 41/66 - (62%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 QRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRK--QEKIG 72
::.|| |...||.||:..|....|||...|:|||..:::.|.:::.||.|:|||:|| :|.:|
Mouse 92 RKAYR--FTPGQLWELQAVFVENQYPDALKRKELAGLLNVDEQKIKDWFNNKRAKYRKIQREILG 154
Fly 73 G 73
|
Mouse 155 G 155
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24329 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.