Sequence 1: | NP_477330.1 | Gene: | Pph13 / 33239 | FlyBaseID: | FBgn0023489 | Length: | 357 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038861.2 | Gene: | Rax / 19434 | MGIID: | 109632 | Length: | 342 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 72/195 - (36%) |
---|---|---|---|
Similarity: | 96/195 - (49%) | Gaps: | 28/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
Fly 72 GGLGGDYKEGALDLDVSYD---DSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAM 133
Fly 134 SPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPP-QTQAQTHPQMDSDNQLQQHPPQQHASDP 197
Fly 198 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pph13 | NP_477330.1 | Homeobox | 14..66 | CDD:278475 | 37/51 (73%) |
Rax | NP_038861.2 | Octapeptide motif | 33..40 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 44..140 | 4/6 (67%) | |||
Homeobox | 140..192 | CDD:278475 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..295 | 23/110 (21%) | |||
OAR | 316..331 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 319..332 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 325..329 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |