DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Rhox6

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_032981.1 Gene:Rhox6 / 19202 MGIID:1202888 Length:227 Species:Mus musculus


Alignment Length:63 Identity:27/63 - (42%)
Similarity:38/63 - (60%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QRRY-RTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            |.|| ||.|...||.:|||.||.|.||.:..|.:||..:.:.|..||.||:.|||.:::..::
Mouse   150 QLRYRRTRFTHSQLHDLERLFQETRYPSLRARRDLARWMGVDECDVQNWFRMRRALFQRNRRV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 26/56 (46%)
Rhox6NP_032981.1 Homeodomain 152..208 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.