DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ceh-54

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001338798.1 Gene:ceh-54 / 188474 WormBaseID:WBGene00020485 Length:221 Species:Caenorhabditis elegans


Alignment Length:78 Identity:36/78 - (46%)
Similarity:50/78 - (64%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTMKR-------KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQN 60
            |.|.||       :::|.|.||:..|:.|:|:.|....|||...||:||.:|.|.|.|||:||||
 Worm    31 KITRKRSNNFNPDRKKRNRITFDANQIDEMEKVFAENQYPDTMSREKLANKIQLHEERVQIWFQN 95

  Fly    61 RRAKWRKQEKIGG 73
            ||||:|:::|..|
 Worm    96 RRAKYRREQKQTG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 28/51 (55%)
ceh-54NP_001338798.1 Homeobox 49..102 CDD:365835 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.