DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and pax-3

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_496189.2 Gene:pax-3 / 185022 WormBaseID:WBGene00003939 Length:308 Species:Caenorhabditis elegans


Alignment Length:200 Identity:50/200 - (25%)
Similarity:66/200 - (33%) Gaps:85/200 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRK------QE 69
            ||.||:|...||..||.||:...||....||.::....|:|.::..||.||||:.||      |.
 Worm   188 RRNRTSFTAEQLDVLENAFRADTYPHANARESISKETGLSEEKIMTWFSNRRARCRKNMPMYQQY 252

  Fly    70 KIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMS 134
            .:.|.|                                   .:||            ||.|...|
 Worm   253 NVQGFG-----------------------------------SSPP------------SYPTLLPS 270

  Fly   135 PSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHASDPIH 199
            |....|:                      :||.|     |.:| :...:.||..||...:|.|  
 Worm   271 PMMFLPS----------------------YSTSP-----QLNP-LFFQHILQSSPPSSQSSPP-- 305

  Fly   200 AGSSS 204
              |||
 Worm   306 --SSS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
pax-3NP_496189.2 PAX 13..141 CDD:238076
Homeodomain 188..244 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.