powered by:
Protein Alignment Pph13 and alr-1
DIOPT Version :9
Sequence 1: | NP_477330.1 |
Gene: | Pph13 / 33239 |
FlyBaseID: | FBgn0023489 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509860.1 |
Gene: | alr-1 / 181302 |
WormBaseID: | WBGene00044330 |
Length: | 362 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 53/69 - (76%) |
Similarity: | 58/69 - (84%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
|.| |||||||||||:..||.|||:.|.||||||||.|||||.|:.||||||||||||||||:|
Worm 111 DNG--KRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYR 173
Fly 67 KQEK 70
|||:
Worm 174 KQER 177
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BSUU |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24329 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5874 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.940 |
|
Return to query results.
Submit another query.