DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and DLX5

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:145 Identity:48/145 - (33%)
Similarity:70/145 - (48%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            :|.|:.||.:::.||..|:|.||:|.|..:..|.|||..:.||:.:|::||||:|:|.:|..|.|
Human   135 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNG 199

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSAL----GGGGTLL------PDTPPQSSNSLDNELKAS 127
            .:..::...      |.|..|.......|:    |...:|.      |.|..||..|...|..||
Human   200 EMPPEHSPS------SSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSAS 258

  Fly   128 YGTGAMSP--SRLSP 140
            :.|.|.|.  |.|.|
Human   259 WYTSAASSINSHLPP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/55 (44%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567
Homeodomain 138..194 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.