DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and DLX3

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:192 Identity:58/192 - (30%)
Similarity:93/192 - (48%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            :|.|:.||.:::.||..|:|.||:..|..:..|.|||.::.||:.:|::||||||:|::|.    
Human   127 KKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKL---- 187

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSR 137
                 ||.|.:.|:.|.::|      ||       :..::||  |.:|.:  .:|:.|.|.:.|:
Human   188 -----YKNGEVPLEHSPNNS------DS-------MACNSPP--SPALWD--TSSHSTPAPARSQ 230

  Fly   138 LSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQ----QHAS 195
            |.|.:..:.:..:|                ...|.:..|.|..|...|||.|||    .|||
Human   231 LPPPLPYSASPSYL----------------DDPTNSWYHAQNLSGPHLQQQPPQPATLHHAS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/55 (44%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 42/130 (32%)
homeobox 129..188 25/67 (37%)
Homeodomain 130..186 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.