DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and DLX1

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_835221.2 Gene:DLX1 / 1745 HGNCID:2914 Length:255 Species:Homo sapiens


Alignment Length:173 Identity:53/173 - (30%)
Similarity:75/173 - (43%) Gaps:45/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72
            :|.|:.||.:::||||.|.|.||:|.|..:..|.|||..:.||:.:|::||||:|:|::|..|.|
Human   126 KKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQG 190

  Fly    73 GLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMSPSR 137
            |       .||:              .|||..|..|...:||.......|   :|.|.|:..   
Human   191 G-------AALE--------------GSALANGRALSAGSPPVPPGWNPN---SSSGKGSGG--- 228

  Fly   138 LSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQ-AQTHPQM 179
                             ..||.:....|.||...| |...||:
Human   229 -----------------NAGSYIPSYTSWYPSAHQEAMQQPQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 26/55 (47%)
DLX1NP_835221.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118
Homeodomain 129..185 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..230 7/48 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.