DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Meox2

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus


Alignment Length:130 Identity:47/130 - (36%)
Similarity:63/130 - (48%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRK 67
            |..:..|.|:.||.|...|::|||..|...:|.....|.|:||.:||||.:|:|||||||.||::
Mouse   179 KSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 243

  Fly    68 QEKIGGLGG---------DYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNE 123
            .:  ||..|         :.|:|.|              |.|.|.|.|..   |..|:.:||.||
Mouse   244 VK--GGQQGAAAREKELVNVKKGTL--------------LPSELSGIGAA---TLQQTGDSLANE 289

  Fly   124  123
            Mouse   290  289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 28/55 (51%)
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 3/11 (27%)
Homeodomain 187..243 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303 6/12 (50%)

Return to query results.
Submit another query.