DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ceh-17

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:65 Identity:50/65 - (76%)
Similarity:59/65 - (90%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            :|||||.||||.:.||:||||:|..|||||::.|||:|:|||||||||||||||||||:||||||
 Worm   146 RRKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKI 210

  Fly    72  71
             Worm   211  210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 41/55 (75%)
ceh-17NP_491393.1 DLL_N 19..112 CDD:463567
Homeodomain 150..206 CDD:459649 41/55 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.