powered by:
Protein Alignment Pph13 and ceh-17
DIOPT Version :9
Sequence 1: | NP_477330.1 |
Gene: | Pph13 / 33239 |
FlyBaseID: | FBgn0023489 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491393.1 |
Gene: | ceh-17 / 172059 |
WormBaseID: | WBGene00000440 |
Length: | 237 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 50/65 - (76%) |
Similarity: | 59/65 - (90%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
:|||||.||||.:.||:||||:|..|||||::.|||:|:|||||||||||||||||||:||||||
Worm 146 RRKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKI 210
Fly 72 71
Worm 211 210
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Pph13 | NP_477330.1 |
Homeobox |
14..66 |
CDD:278475 |
39/51 (76%) |
ceh-17 | NP_491393.1 |
DLL_N |
20..112 |
CDD:403572 |
|
Homeobox |
153..206 |
CDD:395001 |
39/52 (75%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.