DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ARX

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:254 Identity:93/254 - (36%)
Similarity:120/254 - (47%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ::|.:|||||||||||.:.||:|||||||:|||||||.|||||:|:|||||||||||||||||||
Human   320 EEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 384

  Fly    67 KQEKIG------GLGGDYKEGALDLDVSYDDSAVL----GQLDS----ALGGGGTLLPDTPPQSS 117
            |:||.|      ||.......|......|.|::..    ..|||    |........|..||.. 
Human   385 KREKAGAQTHPPGLPFPGPLSATHPLSPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPP- 448

  Fly   118 NSLDNELKASYGTGAMSPS--RLSPNIFLNLNI-DHLGLERGGSGLSMEWSTYPPQTQAQTHPQM 179
                       |:.::.||  .|..:.||...: .|........|  ..:||..|.|.|.|...:
Human   449 -----------GSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFG--RLFSTMAPLTSASTAAAL 500

  Fly   180 DSDNQLQQHPPQQHA-------SDPI------HAGSSSHHQQQQQQHQQEQHNPQLHPG 225
                 |:|..|....       :||.      .|.|.:..:.:.::|..:.....:.||
Human   501 -----LRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPG 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 43/51 (84%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255
Homeobox 332..385 CDD:395001 44/52 (85%)
OAR 526..544 CDD:397759 3/17 (18%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BSUU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41860
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.