DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Hoxb7

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:66 Identity:27/66 - (40%)
Similarity:39/66 - (59%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGGL 74
            ::|.|.|:...|..|||:.|....|.....|.|:|..:.|||.::::||||||.||:|:.|..|.
Mouse   137 RKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGP 201

  Fly    75 G 75
            |
Mouse   202 G 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 23/55 (42%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131
Homeodomain 138..194 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.