DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Hoxa3

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_034582.1 Gene:Hoxa3 / 15400 MGIID:96175 Length:443 Species:Mus musculus


Alignment Length:138 Identity:29/138 - (21%)
Similarity:43/138 - (31%) Gaps:52/138 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KHELMVELKDFDGNYIYARYDEFAIGSEDEQY-------PLMKLGSYT-------GTAGDALNYH 70
            :|..|.||.|.                  .||       .||.:|::.       .|...||...
Mouse     8 RHLRMPELDDL------------------RQYVRSLPTNTLMGMGAFAAITTYWLATRPKALKPP 54

  Fly    71 KDMKFSTVD------------RDNDVSTTHCARYWKGA-----WWYKGCHNSNLNGIYKNSVEGE 118
            .|:...:|:            .|||   ||...|:|.|     ::.:|....|......:...|:
Mouse    55 CDLTMQSVEVPGKEYARRSILMDND---THMTYYYKDALTLYEFFLRGLRVPNNGPCLGSRKAGQ 116

  Fly   119 NIVWNTYK 126
            ...|.:||
Mouse   117 PYKWLSYK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 11/60 (18%)
Hoxa3NP_034582.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..151 14/54 (26%)
Antp-type hexapeptide 156..161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..197
COG5576 <182..309 CDD:227863
Homeodomain 193..249 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..354
DUF4074 378..441 CDD:463833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.