DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Gsc

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus


Alignment Length:82 Identity:38/82 - (46%)
Similarity:53/82 - (64%) Gaps:12/82 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKGTMK------------RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEAR 53
            |:.||:.            |::||:||.|...||:.||..||.|.||||..||:||.::.|.|.:
Mouse   139 MNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEK 203

  Fly    54 VQVWFQNRRAKWRKQEK 70
            |:|||:|||||||:|::
Mouse   204 VEVWFKNRRAKWRRQKR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 32/55 (58%)
GscNP_034481.1 Homeodomain 161..217 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256 5/8 (63%)

Return to query results.
Submit another query.